HAPLN1 antibody (70R-6065)

Rabbit polyclonal HAPLN1 antibody raised against the N terminal of HAPLN1

Synonyms Polyclonal HAPLN1 antibody, Anti-HAPLN1 antibody, HAPLN 1, HAPLN 1 antibody, CRTL1 antibody, Hyaluronan And Proteoglycan Link Protein 1 antibody, HAPLN-1 antibody, HAPLN1, HAPLN-1
Specificity HAPLN1 antibody was raised against the N terminal of HAPLN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL
Assay Information HAPLN1 Blocking Peptide, catalog no. 33R-2605, is also available for use as a blocking control in assays to test for specificity of this HAPLN1 antibody

Images

Western Blot analysis using HAPLN1 antibody (70R-6065)

HAPLN1 antibody (70R-6065) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAPLN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HAPLN1 antibody (70R-6065) | HAPLN1 antibody (70R-6065) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors