Haptoglobin antibody (70R-5419)

Rabbit polyclonal Haptoglobin antibody raised against the middle region of HP

Synonyms Polyclonal Haptoglobin antibody, Anti-Haptoglobin antibody, HP antibody, MGC111141 antibody, hp2-alpha antibody
Specificity Haptoglobin antibody was raised against the middle region of HP
Cross Reactivity Human
Applications WB
Immunogen Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE
Assay Information Haptoglobin Blocking Peptide, catalog no. 33R-6640, is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Images

Western Blot analysis using Haptoglobin antibody (70R-5419)

Haptoglobin antibody (70R-5419) used at 0.0125 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.0125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Haptoglobin antibody (70R-5419) | Haptoglobin antibody (70R-5419) used at 0.0125 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors