Haptoglobin antibody (70R-5459)

Rabbit polyclonal Haptoglobin antibody raised against the N terminal of HP

Synonyms Polyclonal Haptoglobin antibody, Anti-Haptoglobin antibody, hp2-alpha antibody, HP antibody
Specificity Haptoglobin antibody was raised against the N terminal of HP
Cross Reactivity Human
Applications WB
Immunogen Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
Assay Information Haptoglobin Blocking Peptide, catalog no. 33R-6395, is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody


Western Blot analysis using Haptoglobin antibody (70R-5459)

Haptoglobin antibody (70R-5459) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Haptoglobin antibody (70R-5459) | Haptoglobin antibody (70R-5459) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors