HAS3 antibody (70R-7390)

Rabbit polyclonal HAS3 antibody raised against the C terminal of HAS3

Synonyms Polyclonal HAS3 antibody, Anti-HAS3 antibody, HAS 3 antibody, HAS 3, Hyaluronan Synthase 3 antibody, HAS-3 antibody, HAS-3, HAS3
Specificity HAS3 antibody was raised against the C terminal of HAS3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR
Assay Information HAS3 Blocking Peptide, catalog no. 33R-8377, is also available for use as a blocking control in assays to test for specificity of this HAS3 antibody

Images

Western Blot analysis using HAS3 antibody (70R-7390)

HAS3 antibody (70R-7390) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HAS3 antibody (70R-7390) | HAS3 antibody (70R-7390) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors