HAVCR1 antibody (70R-7200)

Rabbit polyclonal HAVCR1 antibody raised against the N terminal of HAVCR1

Synonyms Polyclonal HAVCR1 antibody, Anti-HAVCR1 antibody, TIM-1 antibody, TIM1 antibody, TIMD1 antibody, Hepatitis A Virus Cellular Receptor 1 antibody, HAVCR-1 antibody, HAVCR antibody, KIM1 antibody, KIM-1 antibody
Specificity HAVCR1 antibody was raised against the N terminal of HAVCR1
Cross Reactivity Human
Applications WB
Immunogen HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR
Assay Information HAVCR1 Blocking Peptide, catalog no. 33R-1716, is also available for use as a blocking control in assays to test for specificity of this HAVCR1 antibody

Images

Western Blot analysis using HAVCR1 antibody (70R-7200)

HAVCR1 antibody (70R-7200) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAVCR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HAVCR1 antibody (70R-7200) | HAVCR1 antibody (70R-7200) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors