HAVCR2 antibody (70R-7244)

Rabbit polyclonal HAVCR2 antibody raised against the N terminal of HAVCR2

Synonyms Polyclonal HAVCR2 antibody, Anti-HAVCR2 antibody, TIM3 antibody, FLJ14428 antibody, TIMD3 antibody, Tim-3 antibody, Hepatitis A Virus Cellular Receptor 2 antibody, KIM-3 antibody
Specificity HAVCR2 antibody was raised against the N terminal of HAVCR2
Cross Reactivity Human
Applications WB
Immunogen HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
Assay Information HAVCR2 Blocking Peptide, catalog no. 33R-6002, is also available for use as a blocking control in assays to test for specificity of this HAVCR2 antibody

Images

Western Blot analysis using HAVCR2 antibody (70R-7244)

HAVCR2 antibody (70R-7244) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAVCR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HAVCR2 antibody (70R-7244) | HAVCR2 antibody (70R-7244) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors