HBS1L antibody (70R-1943)

Rabbit polyclonal HBS1L antibody

Synonyms Polyclonal HBS1L antibody, Anti-HBS1L antibody, HSPC276 antibody, DKFZp686L13262 antibody, EF-1a antibody, HBS1, HBS1 antibody, Hbs1-Like antibody, HBS 1, HBS-1, HBS-1 antibody, ERFS antibody, HBS 1 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen HBS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH
Assay Information HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody


Western Blot analysis using HBS1L antibody (70R-1943)

HBS1L antibody (70R-1943) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HBS1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HBS1L antibody (70R-1943) | HBS1L antibody (70R-1943) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors