HCCS Blocking Peptide (33R-10372)

A synthetic peptide for use as a blocking control in assays to test for specificity of HCCS antibody, catalog no. 70R-10236

Synonyms HCCS control peptide, HCCS antibody Blocking Peptide, Anti-HCCS Blocking Peptide, holocytochrome c synthase Blocking Peptide, CCHL Blocking Peptide, DKFZp779I1858 Blocking Peptide, MCOPS7 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTV
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors