HDAC9 antibody (70R-5663)

Rabbit polyclonal HDAC9 antibody raised against the middle region of HDAC9

Synonyms Polyclonal HDAC9 antibody, Anti-HDAC9 antibody, HDAC9B antibody, DKFZp779K1053 antibody, HDAC-9, HDAC9, HDAC antibody, HD7 antibody, KIAA0744 antibody, HDRP antibody, MITR antibody, HDAC9FL antibody, HDAC7 antibody, HDAC-9 antibody, Histone Deacetylase 9 antibody, HDAC 9 antibody, HDAC7B antibody, HDAC 9
Specificity HDAC9 antibody was raised against the middle region of HDAC9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HDAC9 antibody was raised using the middle region of HDAC9 corresponding to a region with amino acids GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI
Assay Information HDAC9 Blocking Peptide, catalog no. 33R-3517, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody

Images

Western Blot analysis using HDAC9 antibody (70R-5663)

HDAC9 antibody (70R-5663) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HDAC9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HDAC9 antibody (70R-5663) | HDAC9 antibody (70R-5663) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors