HDLBP antibody (70R-4762)

Rabbit polyclonal HDLBP antibody

Synonyms Polyclonal HDLBP antibody, Anti-HDLBP antibody, HBP antibody, FLJ16432 antibody, VGL antibody, High Density Lipoprotein Binding Protein antibody, PRO2900 antibody, Vigilin antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV
Assay Information HDLBP Blocking Peptide, catalog no. 33R-8017, is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody


Western Blot analysis using HDLBP antibody (70R-4762)

HDLBP antibody (70R-4762) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HDLBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HDLBP antibody (70R-4762) | HDLBP antibody (70R-4762) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors