HEATR4 antibody (70R-4280)

Rabbit polyclonal HEATR4 antibody raised against the N terminal of HEATR4

Synonyms Polyclonal HEATR4 antibody, Anti-HEATR4 antibody, MGC48595 antibody, HEATR-4, HEATR4, HEATR 4 antibody, HEATR 4, HEATR-4 antibody, Heat Repeat Containing 4 antibody
Specificity HEATR4 antibody was raised against the N terminal of HEATR4
Cross Reactivity Human
Applications WB
Immunogen HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN
Assay Information HEATR4 Blocking Peptide, catalog no. 33R-9524, is also available for use as a blocking control in assays to test for specificity of this HEATR4 antibody

Images

Western Blot analysis using HEATR4 antibody (70R-4280)

HEATR4 antibody (70R-4280) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 112 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEATR4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the HEATR4 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HEATR4 antibody (70R-4280) | HEATR4 antibody (70R-4280) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors