HELLS antibody (70R-4647)

Rabbit polyclonal HELLS antibody raised against the middle region of HELLS

Synonyms Polyclonal HELLS antibody, Anti-HELLS antibody, LSH antibody, PASG antibody, Helicase Lymphoid-Specific antibody, Nbla10143 antibody, FLJ10339 antibody, SMARCA6 antibody
Specificity HELLS antibody was raised against the middle region of HELLS
Cross Reactivity Human
Applications WB
Immunogen HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD
Assay Information HELLS Blocking Peptide, catalog no. 33R-7725, is also available for use as a blocking control in assays to test for specificity of this HELLS antibody

Images

Western Blot analysis using HELLS antibody (70R-4647)

HELLS antibody (70R-4647) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HELLS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HELLS antibody (70R-4647) | HELLS antibody (70R-4647) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors