Heme Oxygenase antibody (70R-5993)

Rabbit polyclonal Heme Oxygenase antibody

Synonyms Polyclonal Heme Oxygenase antibody, Anti-Heme Oxygenase antibody, HO-1 antibody, Decycling 1 antibody, HMOX1 antibody, bK286B10 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Assay Information Heme Oxygenase Blocking Peptide, catalog no. 33R-2708, is also available for use as a blocking control in assays to test for specificity of this Heme Oxygenase antibody

Images

Western Blot analysis using Heme Oxygenase antibody (70R-5993)

Heme Oxygenase antibody (70R-5993) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HMOX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Heme Oxygenase antibody (70R-5993) | Heme Oxygenase antibody (70R-5993) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors