HEPACAM antibody (70R-6943)

Rabbit polyclonal HEPACAM antibody raised against the N terminal of HEPACAM

Synonyms Polyclonal HEPACAM antibody, Anti-HEPACAM antibody, Hepatocyte Cell Adhesion Molecule antibody, FLJ25530 antibody
Specificity HEPACAM antibody was raised against the N terminal of HEPACAM
Cross Reactivity Human
Applications WB
Immunogen HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT
Assay Information HEPACAM Blocking Peptide, catalog no. 33R-5163, is also available for use as a blocking control in assays to test for specificity of this HEPACAM antibody


Western Blot analysis using HEPACAM antibody (70R-6943)

HEPACAM antibody (70R-6943) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEPACAM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HEPACAM antibody (70R-6943) | HEPACAM antibody (70R-6943) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors