HEPH antibody (70R-7345)

Rabbit polyclonal HEPH antibody raised against the N terminal of HEPH

Synonyms Polyclonal HEPH antibody, Anti-HEPH antibody, CPL antibody, Hephaestin antibody, KIAA0698 antibody
Specificity HEPH antibody was raised against the N terminal of HEPH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HEPH antibody was raised using the N terminal of HEPH corresponding to a region with amino acids MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG
Assay Information HEPH Blocking Peptide, catalog no. 33R-6088, is also available for use as a blocking control in assays to test for specificity of this HEPH antibody

Images

Western Blot analysis using HEPH antibody (70R-7345)

HEPH antibody (70R-7345) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEPH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance B1AJX8(HEPH) is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Three transcript variants encoding different isoforms have been described for this gene. The protein encoded by this gene is similar to an iron transport protein found in mouse.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HEPH antibody (70R-7345) | HEPH antibody (70R-7345) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors