HERC4 antibody (70R-2128)

Rabbit polyclonal HERC4 antibody raised against the n terminal of HERC4

Synonyms Polyclonal HERC4 antibody, Anti-HERC4 antibody, Hect Domain And Rld 4 antibody
Specificity HERC4 antibody was raised against the n terminal of HERC4
Cross Reactivity Human,Rat
Applications WB
Immunogen HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL
Assay Information HERC4 Blocking Peptide, catalog no. 33R-6183, is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody


Western Blot analysis using HERC4 antibody (70R-2128)

HERC4 antibody (70R-2128) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HERC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HERC4 antibody (70R-2128) | HERC4 antibody (70R-2128) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors