HERPUD2 antibody (70R-6631)

Rabbit polyclonal HERPUD2 antibody raised against the N terminal of HERPUD2

Synonyms Polyclonal HERPUD2 antibody, Anti-HERPUD2 antibody, FLJ22313 antibody, Herpud Family Member 2 antibody
Specificity HERPUD2 antibody was raised against the N terminal of HERPUD2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen HERPUD2 antibody was raised using the N terminal of HERPUD2 corresponding to a region with amino acids MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL
Assay Information HERPUD2 Blocking Peptide, catalog no. 33R-5864, is also available for use as a blocking control in assays to test for specificity of this HERPUD2 antibody

Images

Western Blot analysis using HERPUD2 antibody (70R-6631)

HERPUD2 antibody (70R-6631) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HERPUD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HERPUD2 could be involved in the unfolded protein response (UPR) pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HERPUD2 antibody (70R-6631) | HERPUD2 antibody (70R-6631) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors