HFE antibody (70R-5983)

Rabbit polyclonal HFE antibody raised against the N terminal of HFE

Synonyms Polyclonal HFE antibody, Anti-HFE antibody, HFE1 antibody, MGC103790 antibody, Hemochromatosis antibody, HH antibody, dJ221C16.10.1 antibody, HLA-H antibody
Specificity HFE antibody was raised against the N terminal of HFE
Cross Reactivity Human
Applications WB
Immunogen HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW
Assay Information HFE Blocking Peptide, catalog no. 33R-6012, is also available for use as a blocking control in assays to test for specificity of this HFE antibody

Images

Western Blot analysis using HFE antibody (70R-5983)

HFE antibody (70R-5983) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HFE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HFE antibody (70R-5983) | HFE antibody (70R-5983) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors