HINT1 Blocking Peptide (33R-1088)

A synthetic peptide for use as a blocking control in assays to test for specificity of HINT1 antibody, catalog no. 70R-4221

Synonyms HINT1 control peptide, HINT1 antibody Blocking Peptide, Anti-HINT1 Blocking Peptide, Histidine Triad Nucleotide Binding Protein 1 Blocking Peptide, FLJ30414 Blocking Peptide, FLJ32340 Blocking Peptide, HINT Blocking Peptide, PKCI-1 Blocking Peptide, PRKCNH1 Blocking Peptide, HINT1, HINT-1, HINT 1, HINT-1 Blocking Peptide, HINT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH
Molecular Weight 14 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors