HIPK4 antibody (70R-3234)

Rabbit polyclonal HIPK4 antibody raised against the middle region of HIPK4

Synonyms Polyclonal HIPK4 antibody, Anti-HIPK4 antibody, Homeodomain Interacting Protein Kinase 4 antibody, HIPK-4 antibody, HIPK 4 antibody, HIPK4, HIPK 4, FLJ32818 antibody, HIPK-4
Specificity HIPK4 antibody was raised against the middle region of HIPK4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET
Assay Information HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody

Images

Western Blot analysis using HIPK4 antibody (70R-3234)

HIPK4 antibody (70R-3234) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIPK4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HIPK4 antibody (70R-3234) | HIPK4 antibody (70R-3234) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors