HLA-DPA1 antibody (70R-5980)

Rabbit polyclonal HLA-DPA1 antibody raised against the middle region of HLA-DPA1

Synonyms Polyclonal HLA-DPA1 antibody, Anti-HLA-DPA1 antibody, Major Histocompatibility Complex Class Ii Dp Alpha 1 antibody, HLASB antibody, HLA-DP1A antibody, HLADP antibody
Specificity HLA-DPA1 antibody was raised against the middle region of HLA-DPA1
Cross Reactivity Human
Applications WB
Immunogen HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
Assay Information HLA-DPA1 Blocking Peptide, catalog no. 33R-2275, is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody

Images

Western Blot analysis using HLA-DPA1 antibody (70R-5980)

HLA-DPA1 antibody (70R-5980) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HLA-DPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HLA-DPA1 antibody (70R-5980) | HLA-DPA1 antibody (70R-5980) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors