HLA-F antibody (70R-6432)

Rabbit polyclonal HLA-F antibody raised against the N terminal of HLA-F

Synonyms Polyclonal HLA-F antibody, Anti-HLA-F antibody, Major Histocompatibility Complex Class I F antibody, HLAF antibody, HLA-5.4 antibody, HLA-CDA12 antibody, CDA12 antibody
Specificity HLA-F antibody was raised against the N terminal of HLA-F
Cross Reactivity Human
Applications WB
Immunogen HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
Assay Information HLA-F Blocking Peptide, catalog no. 33R-7437, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody

Images

Western Blot analysis using HLA-F antibody (70R-6432)

HLA-F antibody (70R-6432) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HLA-F antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HLA-F antibody (70R-6432) | HLA-F antibody (70R-6432) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors