HMGCLL1 antibody (70R-4314)

Rabbit polyclonal HMGCLL1 antibody raised against the N terminal of HMGCLL1

Synonyms Polyclonal HMGCLL1 antibody, Anti-HMGCLL1 antibody, DKFZP434G1411 antibody, 3-Hydroxymethyl-3-Methylglutaryl-Coenzyme A Lyase-Like 1 antibody, bA418P12.1 antibody
Specificity HMGCLL1 antibody was raised against the N terminal of HMGCLL1
Cross Reactivity Human
Applications WB
Immunogen HMGCLL1 antibody was raised using the N terminal of HMGCLL1 corresponding to a region with amino acids MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI
Assay Information HMGCLL1 Blocking Peptide, catalog no. 33R-6052, is also available for use as a blocking control in assays to test for specificity of this HMGCLL1 antibody

Images

Western Blot analysis using HMGCLL1 antibody (70R-4314)

HMGCLL1 antibody (70R-4314) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HMGCLL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HMGCLL1 antibody (70R-4314) | HMGCLL1 antibody (70R-4314) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors