HNF4A antibody (70R-2034)

Rabbit polyclonal HNF4A antibody raised against the middle region of HNF4A

Synonyms Polyclonal HNF4A antibody, Anti-HNF4A antibody, HNF-4 antibody, HNF 4, HNF-4, FLJ39654 antibody, HNF4 antibody, HNF4a7 antibody, HNF4a8 antibody, TCF antibody, HNF4a9 antibody, NR2A21 antibody, MODY antibody, MODY1 antibody, Hepatocyte Nuclear Factor 4 Alpha antibody, HNF 4 antibody, HNF4, TCF14 antibody, NR2A1 antibody
Specificity HNF4A antibody was raised against the middle region of HNF4A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI
Assay Information HNF4A Blocking Peptide, catalog no. 33R-5264, is also available for use as a blocking control in assays to test for specificity of this HNF4A antibody

Western blot analysis using HNF4A antibody (70R-2034)

Recommended HNF4A Antibody Titration: 0.2-1 ug/ml

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNF4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using HNF4A antibody (70R-2034) | Recommended HNF4A Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using HNF4A antibody (70R-2034) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors