HNRNPA2B1 antibody (70R-4660)

Rabbit polyclonal HNRNPA2B1 antibody raised against the N terminal of HNRNPA2B1

Synonyms Polyclonal HNRNPA2B1 antibody, Anti-HNRNPA2B1 antibody, HNRPA2 antibody, HNRPA2B1 antibody, DKFZp779B0244 antibody, SNRPB1 antibody, HNRNPA2B1, HNRNPA2 antibody, HNRNPB1 antibody, Heterogeneous Nuclear Ribonucleoprotein A2/B1 antibody, HNRPB1 antibody, HNRNPAB1-2, RNPA2 antibody, HNRNPAB1 2, HNRNPAB1 2 antibody, FLJ22720 antibody, HNRNPAB1-2 antibody
Specificity HNRNPA2B1 antibody was raised against the N terminal of HNRNPA2B1
Cross Reactivity Human,Rat
Applications WB
Immunogen HNRNPA2B1 antibody was raised using the N terminal of HNRNPA2B1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
Assay Information HNRNPA2B1 Blocking Peptide, catalog no. 33R-5932, is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody

Images

Western Blot analysis using HNRNPA2B1 antibody (70R-4660)

HNRNPA2B1 antibody (70R-4660) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRNPA2B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HNRNPA2B1 antibody (70R-4660) | HNRNPA2B1 antibody (70R-4660) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors