HNRNPR antibody (70R-4656)

Rabbit polyclonal HNRNPR antibody raised against the N terminal of HNRNPR

Synonyms Polyclonal HNRNPR antibody, Anti-HNRNPR antibody, hnRNP-R antibody, HNRPR antibody, Heterogeneous Nuclear Ribonucleoprotein R antibody, FLJ25714 antibody
Specificity HNRNPR antibody was raised against the N terminal of HNRNPR
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ
Assay Information HNRNPR Blocking Peptide, catalog no. 33R-1408, is also available for use as a blocking control in assays to test for specificity of this HNRNPR antibody


Western Blot analysis using HNRNPR antibody (70R-4656)

HNRNPR antibody (70R-4656) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRNPR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HNRNPR antibody (70R-4656) | HNRNPR antibody (70R-4656) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors