HNRPAB antibody (70R-4665)

Rabbit polyclonal HNRPAB antibody raised against the N terminal Of Hnrpab

Synonyms Polyclonal HNRPAB antibody, Anti-HNRPAB antibody, FLJ40338 antibody, ABBP1 antibody, Heterogeneous Nuclear Ribonucleoprotein AB antibody
Specificity HNRPAB antibody was raised against the N terminal Of Hnrpab
Cross Reactivity Human,Mouse
Applications WB
Immunogen HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK
Assay Information HNRPAB Blocking Peptide, catalog no. 33R-3144, is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody

Images

Western blot analysis using HNRPAB antibody (70R-4665)

Recommended HNRPAB Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPAB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using HNRPAB antibody (70R-4665) | Recommended HNRPAB Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors