HNRPD antibody (70R-1320)

Rabbit polyclonal HNRPD antibody

Synonyms Polyclonal HNRPD antibody, Anti-HNRPD antibody, Heterogeneous Nuclear Ribonucleoprotein D antibody, Au-Rich Element Rna Binding Protein 1 antibody
Cross Reactivity Human,Rat,Dog
Applications IHC, WB
Immunogen HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP
Assay Information HNRPD Blocking Peptide, catalog no. 33R-10116, is also available for use as a blocking control in assays to test for specificity of this HNRPD antibody

Images

Immunohistochemical staining using HNRPD antibody (70R-1320)

HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPD belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using HNRPD antibody (70R-1320) | HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.
  • Western Blot analysis using HNRPD antibody (70R-1320) | HNRPD antibody (70R-1320) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using HNRPD antibody (70R-1320) | HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors