HNRPH3 antibody (70R-1326)

Rabbit polyclonal HNRPH3 antibody

Synonyms Polyclonal HNRPH3 antibody, Anti-HNRPH3 antibody, HNRPH-3 antibody, HNRPH 3, Heterogeneous Nuclear Ribonucleoprotein H3 antibody, HNRPH-3, HNRPH 3 antibody, HNRPH3
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
Assay Information HNRPH3 Blocking Peptide, catalog no. 33R-2244, is also available for use as a blocking control in assays to test for specificity of this HNRPH3 antibody

Images

Western Blot analysis using HNRPH3 antibody (70R-1326)

HNRPH3 antibody (70R-1326) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPH3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HNRPH3 antibody (70R-1326) | HNRPH3 antibody (70R-1326) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors