HNRPLL antibody (70R-4841)

Rabbit polyclonal HNRPLL antibody raised against the N terminal of HNRPLL

Synonyms Polyclonal HNRPLL antibody, Anti-HNRPLL antibody, SRRF antibody, Heterogeneous Nuclear Ribonucleoprotein L-Like antibody
Specificity HNRPLL antibody was raised against the N terminal of HNRPLL
Cross Reactivity Human
Applications WB
Immunogen HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG
Assay Information HNRPLL Blocking Peptide, catalog no. 33R-6514, is also available for use as a blocking control in assays to test for specificity of this HNRPLL antibody


Western Blot analysis using HNRPLL antibody (70R-4841)

HNRPLL antibody (70R-4841) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPLL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HNRPLL antibody (70R-4841) | HNRPLL antibody (70R-4841) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors