HNRPM antibody (70R-4998)

Rabbit polyclonal HNRPM antibody raised against the N terminal Of Hnrpm

Synonyms Polyclonal HNRPM antibody, Anti-HNRPM antibody, HNRPM4 antibody, NAGR1 antibody, DKFZp547H118 antibody, HNRNPM4 antibody, HNRNPM antibody, HTGR1 antibody, Heterogeneous Nuclear Ribonucleoprotein M antibody
Specificity HNRPM antibody was raised against the N terminal Of Hnrpm
Cross Reactivity Human
Applications WB
Immunogen HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
Assay Information HNRPM Blocking Peptide, catalog no. 33R-1554, is also available for use as a blocking control in assays to test for specificity of this HNRPM antibody


Western blot analysis using HNRPM antibody (70R-4998)

Recommended HNRPM Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using HNRPM antibody (70R-4998) | Recommended HNRPM Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors