HRB antibody (70R-4741)

Rabbit polyclonal HRB antibody raised against the middle region of HRB

Synonyms Polyclonal HRB antibody, Anti-HRB antibody, Hiv-1 Rev Binding Protein antibody, RIP antibody, MGC116938 antibody, MGC116940 antibody, RAB antibody
Specificity HRB antibody was raised against the middle region of HRB
Cross Reactivity Human,Mouse
Applications WB
Immunogen HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN
Assay Information HRB Blocking Peptide, catalog no. 33R-8725, is also available for use as a blocking control in assays to test for specificity of this HRB antibody


Western Blot analysis using HRB antibody (70R-4741)

HRB antibody (70R-4741) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HRB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HRB antibody (70R-4741) | HRB antibody (70R-4741) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors