HRK antibody (70R-6345)

Rabbit polyclonal HRK antibody

Synonyms Polyclonal HRK antibody, Anti-HRK antibody, HARAKIRI antibody, Harakiri Bcl2 Interacting Protein antibody, DP5 antibody
Cross Reactivity Human
Applications WB
Immunogen HRK antibody was raised using a synthetic peptide corresponding to a region with amino acids MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
Assay Information HRK Blocking Peptide, catalog no. 33R-5817, is also available for use as a blocking control in assays to test for specificity of this HRK antibody

Images

Western Blot analysis using HRK antibody (70R-6345)

HRK antibody (70R-6345) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HRK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HRK antibody (70R-6345) | HRK antibody (70R-6345) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors