HS1BP3 antibody (70R-4018)

Rabbit polyclonal HS1BP3 antibody raised against the N terminal of HS1BP3

Synonyms Polyclonal HS1BP3 antibody, Anti-HS1BP3 antibody, FLJ14249 antibody, ETM2 antibody, Hcls1 Binding Protein 3 antibody, HS1-BP3 antibody
Specificity HS1BP3 antibody was raised against the N terminal of HS1BP3
Cross Reactivity Human
Applications WB
Immunogen HS1BP3 antibody was raised using the N terminal of HS1BP3 corresponding to a region with amino acids YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS
Assay Information HS1BP3 Blocking Peptide, catalog no. 33R-10239, is also available for use as a blocking control in assays to test for specificity of this HS1BP3 antibody

Images

Western Blot analysis using HS1BP3 antibody (70R-4018)

HS1BP3 antibody (70R-4018) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS1BP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HS1BP3 antibody (70R-4018) | HS1BP3 antibody (70R-4018) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors