HS2ST1 antibody (70R-5276)

Rabbit polyclonal HS2ST1 antibody raised against the N terminal of HS2ST1

Synonyms Polyclonal HS2ST1 antibody, Anti-HS2ST1 antibody, MGC131986 antibody, FLJ11317 antibody, KIAA0448 antibody, dJ604K5.2 antibody, Heparan Sulfate 2-O-Sulfotransferase 1 antibody
Specificity HS2ST1 antibody was raised against the N terminal of HS2ST1
Cross Reactivity Human
Applications WB
Immunogen HS2ST1 antibody was raised using the N terminal of HS2ST1 corresponding to a region with amino acids GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR
Assay Information HS2ST1 Blocking Peptide, catalog no. 33R-3410, is also available for use as a blocking control in assays to test for specificity of this HS2ST1 antibody


Western Blot analysis using HS2ST1 antibody (70R-5276)

HS2ST1 antibody (70R-5276) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS2ST1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HS2ST1 antibody (70R-5276) | HS2ST1 antibody (70R-5276) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors