HS3ST3B1 antibody (70R-6860)

Rabbit polyclonal HS3ST3B1 antibody

Synonyms Polyclonal HS3ST3B1 antibody, Anti-HS3ST3B1 antibody, Heparan Sulfate antibody, 30ST3B1 antibody, 3OST3B1 antibody, Glucosamine 3-O-Sulfotransferase 3B1 antibody
Cross Reactivity Human
Applications WB
Immunogen HS3ST3B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
Assay Information HS3ST3B1 Blocking Peptide, catalog no. 33R-1387, is also available for use as a blocking control in assays to test for specificity of this HS3ST3B1 antibody

Images

Western Blot analysis using HS3ST3B1 antibody (70R-6860)

HS3ST3B1 antibody (70R-6860) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS3ST3B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HS3ST3B1 antibody (70R-6860) | HS3ST3B1 antibody (70R-6860) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors