HS6ST3 antibody (70R-7460)

Rabbit polyclonal HS6ST3 antibody raised against the C terminal of HS6ST3

Synonyms Polyclonal HS6ST3 antibody, Anti-HS6ST3 antibody, Heparan Sulfate 6-O-Sulfotransferase 3 antibody, DKFZp761K2315 antibody
Specificity HS6ST3 antibody was raised against the C terminal of HS6ST3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HS6ST3 antibody was raised using the C terminal of HS6ST3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
Assay Information HS6ST3 Blocking Peptide, catalog no. 33R-9146, is also available for use as a blocking control in assays to test for specificity of this HS6ST3 antibody

Images

Western Blot analysis using HS6ST3 antibody (70R-7460)

HS6ST3 antibody (70R-7460) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS6ST3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HS6ST3 antibody (70R-7460) | HS6ST3 antibody (70R-7460) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors