HSD11B1 antibody (70R-7468)

Rabbit polyclonal HSD11B1 antibody

Synonyms Polyclonal HSD11B1 antibody, Anti-HSD11B1 antibody, 11-DH antibody, 11-Beta Dehydrogenase 1 antibody, 11-beta-HSD1 antibody, Hydroxysteroid 11B1 antibody, HSD11B antibody, HSD11 antibody, HDL antibody, HSD11L antibody, MGC13539 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HSD11B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Assay Information HSD11B1 Blocking Peptide, catalog no. 33R-7614, is also available for use as a blocking control in assays to test for specificity of this HSD11B1 antibody

Images

Immunohistochemical staining using HSD11B1 antibody (70R-7468)

HSD11B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSD11B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using HSD11B1 antibody (70R-7468) | HSD11B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using HSD11B1 antibody (70R-7468) | HSD11B1 antibody (70R-7468) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors