HSD17B11 antibody (70R-4589)

Rabbit polyclonal HSD17B11 antibody

Synonyms Polyclonal HSD17B11 antibody, Anti-HSD17B11 antibody, RETSDR2 antibody, 17-Beta Dehydrogenase 11 antibody, 17-BETA-HSDXI antibody, PAN1B antibody, DHRS8 antibody, 17-BETA-HSD11 antibody, Hydroxysteroid 17B11 antibody
Cross Reactivity Human
Applications WB
Immunogen HSD17B11 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
Assay Information HSD17B11 Blocking Peptide, catalog no. 33R-9080, is also available for use as a blocking control in assays to test for specificity of this HSD17B11 antibody


Western Blot analysis using HSD17B11 antibody (70R-4589)

HSD17B11 antibody (70R-4589) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSD17B11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSD17B11 antibody (70R-4589) | HSD17B11 antibody (70R-4589) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors