HSD3B2 antibody (70R-6441)

Rabbit polyclonal HSD3B2 antibody raised against the N terminal of HSD3B2

Synonyms Polyclonal HSD3B2 antibody, Anti-HSD3B2 antibody, HSDB antibody, Hydroxy-Delta-5-Steroid Dehydrogenase 3 Beta- And Steroid Delta-Isomerase 2 antibody, HSDB3 antibody
Specificity HSD3B2 antibody was raised against the N terminal of HSD3B2
Cross Reactivity Human
Applications WB
Immunogen HSD3B2 antibody was raised using the N terminal of HSD3B2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
Assay Information HSD3B2 Blocking Peptide, catalog no. 33R-3671, is also available for use as a blocking control in assays to test for specificity of this HSD3B2 antibody


Western Blot analysis using HSD3B2 antibody (70R-6441)

HSD3B2 antibody (70R-6441) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSD3B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSD3B2 antibody (70R-6441) | HSD3B2 antibody (70R-6441) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors