HSD3B7 antibody (70R-4491)

Rabbit polyclonal HSD3B7 antibody raised against the middle region of HSD3B7

Synonyms Polyclonal HSD3B7 antibody, Anti-HSD3B7 antibody, PFIC4 antibody, Hydroxy-Delta-5-Steroid Dehydrogenase 3 Beta- And Steroid Delta-Isomerase 7 antibody
Specificity HSD3B7 antibody was raised against the middle region of HSD3B7
Cross Reactivity Human
Applications WB
Immunogen HSD3B7 antibody was raised using the middle region of HSD3B7 corresponding to a region with amino acids QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
Assay Information HSD3B7 Blocking Peptide, catalog no. 33R-7574, is also available for use as a blocking control in assays to test for specificity of this HSD3B7 antibody


Western Blot analysis using HSD3B7 antibody (70R-4491)

HSD3B7 antibody (70R-4491) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSD3B7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSD3B7 antibody (70R-4491) | HSD3B7 antibody (70R-4491) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors