HSPA1A antibody (70R-1244)

Rabbit polyclonal HSPA1A antibody raised against the middle region of HSPA1A

Synonyms Polyclonal HSPA1A antibody, Anti-HSPA1A antibody, HSP70 antibody, HSP70-1A antibody, HSP 70 antibody, HSP-70 antibody, HSP 70, Heat Shock 70Kda Protein 1A antibody, HSP70, HSP-70
Specificity HSPA1A antibody was raised against the middle region of HSPA1A
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans,ZebraFish
Applications WB
Immunogen HSPA1A antibody was raised using the middle region of HSPA1A corresponding to a region with amino acids SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV
Assay Information HSPA1A Blocking Peptide, catalog no. 33R-8583, is also available for use as a blocking control in assays to test for specificity of this HSPA1A antibody

Images

Western Blot analysis using HSPA1A antibody (70R-1244)

HSPA1A antibody (70R-1244) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HSPA1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HSPA1A antibody (70R-1244) | HSPA1A antibody (70R-1244) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors