HSPA6 antibody (70R-3829)

Rabbit polyclonal HSPA6 antibody

Synonyms Polyclonal HSPA6 antibody, Anti-HSPA6 antibody, HSP70 antibody, HSP-70, Heat Shock 70Kda Protein 6 antibody, HSP70, HSP-70 antibody, Hsp70B antibody, HSP 70 antibody, HSP 70, HSP70-6 antibody
Cross Reactivity Human
Applications WB
Immunogen HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV
Assay Information HSPA6 Blocking Peptide, catalog no. 33R-2819, is also available for use as a blocking control in assays to test for specificity of this HSPA6 antibody

Western Blot analysis using HSPA6 antibody (70R-3829)

HSPA6 antibody (70R-3829) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using HSPA6 antibody (70R-3829) | HSPA6 antibody (70R-3829) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors