HSPA8 antibody (70R-4109)

Rabbit polyclonal HSPA8 antibody raised against the N terminal of HSPA8

Synonyms Polyclonal HSPA8 antibody, Anti-HSPA8 antibody, HSP-70 antibody, HSPA10 antibody, LAP1 antibody, HSC70 antibody, HSP73 antibody, HSC54 antibody, HSP70 antibody, HSP-70, HSP 70 antibody, MGC29929 antibody, HSP 70, HSP70-8 antibody, HSP70, Heat Shock 70Kda Protein 8 antibody, NIP71 antibody, HSC71 antibody, MGC131511 antibody, HSP71 antibody
Specificity HSPA8 antibody was raised against the N terminal of HSPA8
Cross Reactivity Human, Mouse, Rat, Dog, Arabidopsis, C.elegans, Drosophila
Applications WB
Immunogen HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Assay Information HSPA8 Blocking Peptide, catalog no. 33R-9900, is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody


Immunohistochemical staining using HSPA8 antibody (70R-4109)

HSPA8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HSPA8 antibody (70R-4109) | HSPA8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using HSPA8 antibody (70R-4109) | HSPA8 antibody (70R-4109) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using HSPA8 antibody (70R-4109) | HSPA8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors