HSPB8 Blocking Peptide (33R-1092)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB8 antibody, catalog no. 70R-2328

Synonyms HSPB8 control peptide, HSPB8 antibody Blocking Peptide, Anti-HSPB8 Blocking Peptide, Heat Shock 22Kda Protein 8 Blocking Peptide, CMT2L Blocking Peptide, DHMN2 Blocking Peptide, E2IG1 Blocking Peptide, H11 Blocking Peptide, HMN2 Blocking Peptide, HMN2A Blocking Peptide, HSP22 Blocking Peptide, HSP22 Blocking Peptide, HSP22, HSP-22, HSP 22, HSP-22 Blocking Peptide, HSP 22 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors