HSPH1 antibody (70R-2235)

Rabbit polyclonal HSPH1 antibody raised against the middle region of HSPH1

Synonyms Polyclonal HSPH1 antibody, Anti-HSPH1 antibody, HSP 105 antibody, DKFZp686M05240 antibody, NY-CO-25 antibody, HSP-105, Heat Shock 105Kda/110Kda Protein 1 antibody, HSP 105, HSP105 antibody, KIAA0201 antibody, HSP105A antibody, HSP-105 antibody, HSP105, HSP105B antibody, HSP105 antibody
Specificity HSPH1 antibody was raised against the middle region of HSPH1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ
Assay Information HSPH1 Blocking Peptide, catalog no. 33R-2377, is also available for use as a blocking control in assays to test for specificity of this HSPH1 antibody

Images

Western Blot analysis using HSPH1 antibody (70R-2235)

HSPH1 antibody (70R-2235) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HSPH1 antibody (70R-2235) | HSPH1 antibody (70R-2235) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors