HUS1B antibody (70R-2339)

Rabbit polyclonal HUS1B antibody

Synonyms Polyclonal HUS1B antibody, Anti-HUS1B antibody, HUS-1, MGC126746 antibody, HUS 1 antibody, Hus1 Checkpoint Homolog B antibody, RP11-532F6.1 antibody, HUS-1 antibody, MGC126748 antibody, HUS 1, HUS1
Cross Reactivity Human
Applications WB
Immunogen HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF
Assay Information HUS1B Blocking Peptide, catalog no. 33R-2540, is also available for use as a blocking control in assays to test for specificity of this HUS1B antibody

Images

Western Blot analysis using HUS1B antibody (70R-2339)

HUS1B antibody (70R-2339) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HUS1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HUS1B antibody (70R-2339) | HUS1B antibody (70R-2339) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors