HYOU1 antibody (70R-6400)

Rabbit polyclonal HYOU1 antibody raised against the middle region of HYOU1

Synonyms Polyclonal HYOU1 antibody, Anti-HYOU1 antibody, Hypoxia Up-Regulated 1 antibody, ORP150 antibody, DKFZp686N08236 antibody
Specificity HYOU1 antibody was raised against the middle region of HYOU1
Cross Reactivity Human
Applications WB
Immunogen HYOU1 antibody was raised using the middle region of HYOU1 corresponding to a region with amino acids DREVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQT
Assay Information HYOU1 Blocking Peptide, catalog no. 33R-2141, is also available for use as a blocking control in assays to test for specificity of this HYOU1 antibody

Images

Western Blot analysis using HYOU1 antibody (70R-6400)

HYOU1 antibody (70R-6400) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HYOU1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HYOU1 antibody (70R-6400) | HYOU1 antibody (70R-6400) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors