IARS antibody (70R-3179)

Rabbit polyclonal IARS antibody raised against the N terminal of IARS

Synonyms Polyclonal IARS antibody, Anti-IARS antibody, ILRS antibody, IARS1 antibody, FLJ20736 antibody, PRO0785 antibody, Isoleucyl-tRNA Synthetase antibody
Specificity IARS antibody was raised against the N terminal of IARS
Cross Reactivity Human
Applications WB
Immunogen IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG
Assay Information IARS Blocking Peptide, catalog no. 33R-8554, is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Images

Western Blot analysis using IARS antibody (70R-3179)

IARS antibody (70R-3179) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 144 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IARS antibody (70R-3179) | IARS antibody (70R-3179) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors