ICAM5 antibody (70R-6140)

Rabbit polyclonal ICAM5 antibody raised against the N terminal of ICAM5

Synonyms Polyclonal ICAM5 antibody, Anti-ICAM5 antibody, ICAM 5 antibody, ICAM-5 antibody, TLCN antibody, Intercellular Adhesion Molecule 5 Telencephalin antibody, ICAM-5, ICAM5, TLN antibody, ICAM 5
Specificity ICAM5 antibody was raised against the N terminal of ICAM5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ICAM5 antibody was raised using the N terminal of ICAM5 corresponding to a region with amino acids RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD
Assay Information ICAM5 Blocking Peptide, catalog no. 33R-8151, is also available for use as a blocking control in assays to test for specificity of this ICAM5 antibody


Western Blot analysis using ICAM5 antibody (70R-6140)

ICAM5 antibody (70R-6140) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ICAM5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ICAM5 antibody (70R-6140) | ICAM5 antibody (70R-6140) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors